| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329884.1 | internal | 275 | 2-826(+) |
Amino Acid sequence : | |||
| SHLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGV HGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDK TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGW | |||
Physicochemical properties | |||
| Number of amino acids: | 275 | ||
| Molecular weight: | 30,123.726 | ||
| Theoretical pI: | 5.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
| Instability index: | 32.898 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.218 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329884.1 | internal | 275 | 2-826(+) |
Amino Acid sequence : | |||
| SHLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGV HGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDK TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGW | |||
Physicochemical properties | |||
| Number of amino acids: | 275 | ||
| Molecular weight: | 30,123.726 | ||
| Theoretical pI: | 5.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
| Instability index: | 32.898 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.218 | ||
| sheet | 0.204 | ||