| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329890.1 | internal | 241 | 2-724(+) |
Amino Acid sequence : | |||
| ETIVELDDAVMESYLEGLEPDEATIKKLVRQGTISSSFVPVLCGSAFKNKGVQPLLDAVVDYLPSPVELPAMKGTDPEDPELIIERASDDGEPFAGLAFKIMSDPFVGSLTFVRVYSGKL DSGSYVLNANKGKKERIGRLLEMHANSREDVKVALTGDIVALAGLKDTITGETLCDPEKPIVLERMDFPDPVIKVAIEPKTKADVDKMAVGLIKLAQEDPSFHFSRDEETNQTVIEGMGE L | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 12,411.913 | ||
| Theoretical pI: | 9.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 58.929 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.128 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.420 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329890.1 | complete | 119 | 543-184(-) |
Amino Acid sequence : | |||
| MGFSGSHNVSPVIVSFRPASATISPVRATFTSSLLLACISKSLPILSFFPLFAFSTYDPESSFPEYTRTNVREPTKGSLMILKANPANGSPSSEALSMISSGSSGSVPFIAGNSTGEGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,411.913 | ||
| Theoretical pI: | 9.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 58.929 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.128 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.420 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329890.1 | internal | 241 | 2-724(+) |
Amino Acid sequence : | |||
| ETIVELDDAVMESYLEGLEPDEATIKKLVRQGTISSSFVPVLCGSAFKNKGVQPLLDAVVDYLPSPVELPAMKGTDPEDPELIIERASDDGEPFAGLAFKIMSDPFVGSLTFVRVYSGKL DSGSYVLNANKGKKERIGRLLEMHANSREDVKVALTGDIVALAGLKDTITGETLCDPEKPIVLERMDFPDPVIKVAIEPKTKADVDKMAVGLIKLAQEDPSFHFSRDEETNQTVIEGMGE L | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 12,411.913 | ||
| Theoretical pI: | 9.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 58.929 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.128 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.420 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329890.1 | complete | 119 | 543-184(-) |
Amino Acid sequence : | |||
| MGFSGSHNVSPVIVSFRPASATISPVRATFTSSLLLACISKSLPILSFFPLFAFSTYDPESSFPEYTRTNVREPTKGSLMILKANPANGSPSSEALSMISSGSSGSVPFIAGNSTGEGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,411.913 | ||
| Theoretical pI: | 9.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 58.929 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.128 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.420 | ||
| sheet | 0.218 | ||