| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329904.1 | 5prime_partial | 233 | 2-703(+) |
Amino Acid sequence : | |||
| CALVGGGGYAEKVAVPAGQVLPVPPNVSLQDAASFPEVACTVWSTVFMMSHLSKGETFLIHGGSSGIGTFAIQLAKYLGIKVFITAGSEEKLAACKELGADVCINYKTEDFVSRIKEETG GKGVDVILDNIGASYLQRNLESLSFNGRLFIIGFMGGSVTEINLGILLAKRLTVQAAGLRNRSPENKAAIVSEVEKNVWPANCCRKDKTSGVRALPTGKSCKRSPVSWKATSI* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 15,611.363 | ||
| Theoretical pI: | 10.444 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 52.089 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.250 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329904.1 | 5prime_partial | 140 | 738-316(-) |
Amino Acid sequence : | |||
| QKTLGNIQYYLSYMLVAFQDTGDLLQLFPVGSARTPLVLSFLQQFAGQTFFSTSLTIAALFSGLLFRSPAACTVRRFASKIPRLISVTDPPIKPIIKSLPLKLRLSRFRCKYEAPMLSKM TSTPFPPVSSLMRETKSSVL* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,611.363 | ||
| Theoretical pI: | 10.444 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 52.089 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.250 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329904.1 | 5prime_partial | 233 | 2-703(+) |
Amino Acid sequence : | |||
| CALVGGGGYAEKVAVPAGQVLPVPPNVSLQDAASFPEVACTVWSTVFMMSHLSKGETFLIHGGSSGIGTFAIQLAKYLGIKVFITAGSEEKLAACKELGADVCINYKTEDFVSRIKEETG GKGVDVILDNIGASYLQRNLESLSFNGRLFIIGFMGGSVTEINLGILLAKRLTVQAAGLRNRSPENKAAIVSEVEKNVWPANCCRKDKTSGVRALPTGKSCKRSPVSWKATSI* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 15,611.363 | ||
| Theoretical pI: | 10.444 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 52.089 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.250 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329904.1 | 5prime_partial | 140 | 738-316(-) |
Amino Acid sequence : | |||
| QKTLGNIQYYLSYMLVAFQDTGDLLQLFPVGSARTPLVLSFLQQFAGQTFFSTSLTIAALFSGLLFRSPAACTVRRFASKIPRLISVTDPPIKPIIKSLPLKLRLSRFRCKYEAPMLSKM TSTPFPPVSSLMRETKSSVL* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,611.363 | ||
| Theoretical pI: | 10.444 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 52.089 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.250 | ||
| sheet | 0.257 | ||