| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329910.1 | internal | 263 | 3-791(+) |
Amino Acid sequence : | |||
| ALASARETPVRLDQMLNVCATNAIARVMLGRRVVGHGGGGGDEKAEEFKAMVVELMVLAGVFNIGDFIPALERFDLQGVVGKMKKLHQRFDAFLTAIVEEHKTDVCRRHTDLLSTLISLK DDDDSEGGKLTDTEIKALLLNLFTAGTDTTSSTVEWAIAELIRHPKILARAQQELHSVVGSNRFVTESDLPRLVYLQAVIKENFRLHPSTPLSLPRIAGENCVVNGYHIPKGSTLLVNVW AISRDPNQWVDPLKFRPDRFLPG | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 17,066.705 | ||
| Theoretical pI: | 11.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 61.040 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.296 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.352 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329910.1 | 3prime_partial | 162 | 487-2(-) |
Amino Acid sequence : | |||
| MSSAMAHSTVLDVVSVPAVNKFKSKALISVSVSFPPSLSSSSLSEINVLNKSVCLRQTSVLCSSTIAVRKASKRWCSFFIFPTTPCRSNLSSAGMKSPMLKTPANTISSTTIALNSSAFS SPPPPPCPTTRLPSITRAIAFVAHTFSIWSSRTGVSLALARA | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 17,066.705 | ||
| Theoretical pI: | 11.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 61.040 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.296 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.352 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329910.1 | internal | 263 | 3-791(+) |
Amino Acid sequence : | |||
| ALASARETPVRLDQMLNVCATNAIARVMLGRRVVGHGGGGGDEKAEEFKAMVVELMVLAGVFNIGDFIPALERFDLQGVVGKMKKLHQRFDAFLTAIVEEHKTDVCRRHTDLLSTLISLK DDDDSEGGKLTDTEIKALLLNLFTAGTDTTSSTVEWAIAELIRHPKILARAQQELHSVVGSNRFVTESDLPRLVYLQAVIKENFRLHPSTPLSLPRIAGENCVVNGYHIPKGSTLLVNVW AISRDPNQWVDPLKFRPDRFLPG | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 17,066.705 | ||
| Theoretical pI: | 11.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 61.040 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.296 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.352 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329910.1 | 3prime_partial | 162 | 487-2(-) |
Amino Acid sequence : | |||
| MSSAMAHSTVLDVVSVPAVNKFKSKALISVSVSFPPSLSSSSLSEINVLNKSVCLRQTSVLCSSTIAVRKASKRWCSFFIFPTTPCRSNLSSAGMKSPMLKTPANTISSTTIALNSSAFS SPPPPPCPTTRLPSITRAIAFVAHTFSIWSSRTGVSLALARA | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 17,066.705 | ||
| Theoretical pI: | 11.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 61.040 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.296 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.352 | ||
| sheet | 0.210 | ||