| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329938.1 | internal | 282 | 1-846(+) |
Amino Acid sequence : | |||
| IEQQSPDIAQGVHGHLSKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVI KPVIPAQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDILA LIXENFDFRPGMIAINLYLKRGGNFRYQKTAAYGHFGRDDPD | |||
Physicochemical properties | |||
| Number of amino acids: | 282 | ||
| Molecular weight: | 12,690.316 | ||
| Theoretical pI: | 4.546 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.813 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.230 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329938.1 | complete | 113 | 510-169(-) |
Amino Acid sequence : | |||
| MSTPATICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,690.316 | ||
| Theoretical pI: | 4.546 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.813 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.230 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329938.1 | internal | 282 | 1-846(+) |
Amino Acid sequence : | |||
| IEQQSPDIAQGVHGHLSKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVI KPVIPAQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDILA LIXENFDFRPGMIAINLYLKRGGNFRYQKTAAYGHFGRDDPD | |||
Physicochemical properties | |||
| Number of amino acids: | 282 | ||
| Molecular weight: | 12,690.316 | ||
| Theoretical pI: | 4.546 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.813 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.230 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329938.1 | complete | 113 | 510-169(-) |
Amino Acid sequence : | |||
| MSTPATICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,690.316 | ||
| Theoretical pI: | 4.546 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.813 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.230 | ||
| sheet | 0.230 | ||