| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329953.1 | complete | 191 | 241-816(+) |
Amino Acid sequence : | |||
| MVRRTNPTRKAWAQPELSRAANSGIFHVCGDWLSTNAHHRLHSQRAVGANGAGASANVADGVVVGAAAAVVLAARGALEGAAPPREAVAVEFKQAAAGIACRACVVGAADGWRWWRGARI RRSGAGVWRVGGFLDRVGRLNGNTAETCFGLNIPLHSEVPFFTPFRAPRVPHYPVIHPVFTTVSYRIHTVV* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 18,715.098 | ||
| Theoretical pI: | 7.540 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37775 | ||
| Instability index: | 43.143 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.322 | ||
Secondary Structure Fraction | |||
| Helix | 0.229 | ||
| turn | 0.383 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329953.1 | 5prime_partial | 175 | 819-292(-) |
Amino Acid sequence : | |||
| NLDHGVNAVGYGSENGMDYWIVRNSWGAEWGEKGYLRMQRNIKTKTGLCGIAVEPSYPIKKTPNPPNPGPTPPNPSPPPPSPSVCSTYYACPAGDTCCCLFEFYGYCFSWGCCPLEGASC CQDHSSCCPHDYPVCNVRAGTCSISANSPLGVKPMVSVRAKPIATYMKDAGISSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,715.098 | ||
| Theoretical pI: | 7.540 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37775 | ||
| Instability index: | 43.143 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.322 | ||
Secondary Structure Fraction | |||
| Helix | 0.229 | ||
| turn | 0.383 | ||
| sheet | 0.154 | ||