Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329953.1 | complete | 191 | 241-816(+) |
Amino Acid sequence : | |||
MVRRTNPTRKAWAQPELSRAANSGIFHVCGDWLSTNAHHRLHSQRAVGANGAGASANVADGVVVGAAAAVVLAARGALEGAAPPREAVAVEFKQAAAGIACRACVVGAADGWRWWRGARI RRSGAGVWRVGGFLDRVGRLNGNTAETCFGLNIPLHSEVPFFTPFRAPRVPHYPVIHPVFTTVSYRIHTVV* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 18,715.098 | ||
Theoretical pI: | 7.540 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37775 | ||
Instability index: | 43.143 | ||
aromaticity | 0.097 | ||
GRAVY | -0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.383 | ||
sheet | 0.154 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY329953.1 | 5prime_partial | 175 | 819-292(-) |
Amino Acid sequence : | |||
NLDHGVNAVGYGSENGMDYWIVRNSWGAEWGEKGYLRMQRNIKTKTGLCGIAVEPSYPIKKTPNPPNPGPTPPNPSPPPPSPSVCSTYYACPAGDTCCCLFEFYGYCFSWGCCPLEGASC CQDHSSCCPHDYPVCNVRAGTCSISANSPLGVKPMVSVRAKPIATYMKDAGISSS* | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 18,715.098 | ||
Theoretical pI: | 7.540 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37775 | ||
Instability index: | 43.143 | ||
aromaticity | 0.097 | ||
GRAVY | -0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.383 | ||
sheet | 0.154 |