| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329966.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
| RSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGFDADNCKVLVNIEQQSPDIAQGVHGH LTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVILAKYLDDXTIF HLNPSGRF | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 27,272.504 | ||
| Theoretical pI: | 5.067 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 35.626 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.391 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.202 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329966.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
| RSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGFDADNCKVLVNIEQQSPDIAQGVHGH LTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVILAKYLDDXTIF HLNPSGRF | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 27,272.504 | ||
| Theoretical pI: | 5.067 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 35.626 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.391 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.202 | ||
| sheet | 0.215 | ||