| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329990.1 | internal | 276 | 2-829(+) |
Amino Acid sequence : | |||
| KNLSCSSLEVDEMADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGV HGHLTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYDNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKYLDEK TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWG | |||
Physicochemical properties | |||
| Number of amino acids: | 276 | ||
| Molecular weight: | 11,980.172 | ||
| Theoretical pI: | 4.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 23.894 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.235 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329990.1 | complete | 149 | 466-17(-) |
Amino Acid sequence : | |||
| MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRHFVDLER* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 11,980.172 | ||
| Theoretical pI: | 4.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 23.894 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.235 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329990.1 | 5prime_partial | 115 | 829-482(-) |
Amino Acid sequence : | |||
| PPPAVGVDDDLTAGETRVAVGPTDDETPGGIKVEDGFLVQILRGDHRLDDVLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPVGSQPGARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 11,980.172 | ||
| Theoretical pI: | 4.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 23.894 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.235 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329990.1 | internal | 276 | 2-829(+) |
Amino Acid sequence : | |||
| KNLSCSSLEVDEMADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGV HGHLTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYDNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKYLDEK TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWG | |||
Physicochemical properties | |||
| Number of amino acids: | 276 | ||
| Molecular weight: | 11,980.172 | ||
| Theoretical pI: | 4.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 23.894 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.235 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329990.1 | complete | 149 | 466-17(-) |
Amino Acid sequence : | |||
| MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRHFVDLER* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 11,980.172 | ||
| Theoretical pI: | 4.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 23.894 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.235 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY329990.1 | 5prime_partial | 115 | 829-482(-) |
Amino Acid sequence : | |||
| PPPAVGVDDDLTAGETRVAVGPTDDETPGGIKVEDGFLVQILRGDHRLDDVLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPVGSQPGARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 11,980.172 | ||
| Theoretical pI: | 4.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 23.894 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.235 | ||
| sheet | 0.226 | ||