| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330006.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| ISSTKLLSQNPKFLPSFSGNNMLCSNAVRAAQTVHPVPGFGSDEMERVAQQTLTRYTFDGAQQQRGKGVAIVWFRNDLRILDNEVLYKAWISSEAVLPVYCVDPRLFGATHYFGFPKTGA LRAKFLIECLADLRKNLTKRGLNLLIQQGKPEHVLPSLAKAYGVHTVYAQKETCSEELNVERLVSKNLQKIVLEPAEGVSAKHKSRNGTKLELIWGSTMYHIDDLPFSCTSLPDIYTQ | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,628.300 | ||
| Theoretical pI: | 9.044 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
| Instability index: | 41.724 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.231 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330006.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| ISSTKLLSQNPKFLPSFSGNNMLCSNAVRAAQTVHPVPGFGSDEMERVAQQTLTRYTFDGAQQQRGKGVAIVWFRNDLRILDNEVLYKAWISSEAVLPVYCVDPRLFGATHYFGFPKTGA LRAKFLIECLADLRKNLTKRGLNLLIQQGKPEHVLPSLAKAYGVHTVYAQKETCSEELNVERLVSKNLQKIVLEPAEGVSAKHKSRNGTKLELIWGSTMYHIDDLPFSCTSLPDIYTQ | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,628.300 | ||
| Theoretical pI: | 9.044 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
| Instability index: | 41.724 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.231 | ||
| sheet | 0.256 | ||