| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330013.1 | 5prime_partial | 232 | 889-191(-) |
Amino Acid sequence : | |||
| PQKLKSIFVISGHWETAEPSVNAVSGPSATIHDFYRFPDQMYRLKYPAPGSPELADRVKQLLNKSGFETVHVDDTRGLDHGAWVPLMLMYPEADIPVVQLSVQTDKDASHHYRLGEALRP LKEDGVLIFGSGAATHNLRKISRDGSNEVAEWAEEFDRWIGKALEEGRYEDVNRYEEKAPHAKMAHPWPDHFYPLHVAMGAAGENTRGELIHHSWTHGTLSYASYRFAEKAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 17,142.477 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 82.138 | ||
| aromaticity | 0.000 | ||
| GRAVY | -1.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.167 | ||
| turn | 0.314 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330013.1 | complete | 181 | 161-706(+) |
Amino Acid sequence : | |||
| MHKQVKTKLSLFSFLGESVRRIGQGPVRPAMVDELAPRVLAGGAHRHVQRVEMVRPGVRHLRVRRLLLIPIHILIPPLLQRLPDPPVKLLRPLRHLVAAVAADLPQIVRGGAGSEYQDAV LLQRPQRLAEAVVVRGVLVGLHRQLDHRNVRLRIHQHERDPRAVVQPARVVHVDGFESGFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 17,142.477 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 82.138 | ||
| aromaticity | 0.000 | ||
| GRAVY | -1.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.167 | ||
| turn | 0.314 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330013.1 | 5prime_partial | 156 | 890-420(-) |
Amino Acid sequence : | |||
| PPKTKIHLRNLRPLGDRRALRQRRLRPLRHHPRLLPLPRPDVPPQVPRPRLAGARGSREAVVKQIRIRNRPRGRHARAGPRRVGPAHADVSGGGHSGGPAVGADRQGRLAPLPPRRGAAA AEGGRRPDIRIRRRHAQSEEDQPRRQQRGGGVGGGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,142.477 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 82.138 | ||
| aromaticity | 0.000 | ||
| GRAVY | -1.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.167 | ||
| turn | 0.314 | ||
| sheet | 0.205 | ||