Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330013.1 | 5prime_partial | 232 | 889-191(-) |
Amino Acid sequence : | |||
PQKLKSIFVISGHWETAEPSVNAVSGPSATIHDFYRFPDQMYRLKYPAPGSPELADRVKQLLNKSGFETVHVDDTRGLDHGAWVPLMLMYPEADIPVVQLSVQTDKDASHHYRLGEALRP LKEDGVLIFGSGAATHNLRKISRDGSNEVAEWAEEFDRWIGKALEEGRYEDVNRYEEKAPHAKMAHPWPDHFYPLHVAMGAAGENTRGELIHHSWTHGTLSYASYRFAEKAK* | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 17,142.477 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 82.138 | ||
aromaticity | 0.000 | ||
GRAVY | -1.139 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.314 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330013.1 | complete | 181 | 161-706(+) |
Amino Acid sequence : | |||
MHKQVKTKLSLFSFLGESVRRIGQGPVRPAMVDELAPRVLAGGAHRHVQRVEMVRPGVRHLRVRRLLLIPIHILIPPLLQRLPDPPVKLLRPLRHLVAAVAADLPQIVRGGAGSEYQDAV LLQRPQRLAEAVVVRGVLVGLHRQLDHRNVRLRIHQHERDPRAVVQPARVVHVDGFESGFV* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 17,142.477 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 82.138 | ||
aromaticity | 0.000 | ||
GRAVY | -1.139 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.314 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330013.1 | 5prime_partial | 156 | 890-420(-) |
Amino Acid sequence : | |||
PPKTKIHLRNLRPLGDRRALRQRRLRPLRHHPRLLPLPRPDVPPQVPRPRLAGARGSREAVVKQIRIRNRPRGRHARAGPRRVGPAHADVSGGGHSGGPAVGADRQGRLAPLPPRRGAAA AEGGRRPDIRIRRRHAQSEEDQPRRQQRGGGVGGGV* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,142.477 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 82.138 | ||
aromaticity | 0.000 | ||
GRAVY | -1.139 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.314 | ||
sheet | 0.205 |