Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330021.1 | 5prime_partial | 260 | 894-112(-) |
Amino Acid sequence : | |||
PCTIACFASEKHDMTLCARCYVRGNYRVGLNSSDFKRVEISDEAKSDWSEKETLQLLEAIMHYGDDWKKVAEHVGGRNVKECVTRFIKLPFGEQFDGPPESGELDTEFGLQNATLPAKRM HLSPLADASNPIMAQSAFLSTLVGVDVAEMAARAAVTALSNVGEGKQQEFSGGDAPNNMEESLNEAKSELEKEEAELEKAISGITTQSKEIAEKMLQYEEMDLQMERKWQQFQQLQNMLF VDQLTILFHKNTADKSVEPD* | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 12,541.161 | ||
Theoretical pI: | 9.959 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 55.080 | ||
aromaticity | 0.114 | ||
GRAVY | 0.629 | ||
Secondary Structure Fraction | |||
Helix | 0.486 | ||
turn | 0.143 | ||
sheet | 0.324 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330021.1 | complete | 105 | 103-420(+) |
Amino Acid sequence : | |||
MEMSIRFHRLVGSVLMKKNSQLINKEHVLKLLELLPFPLHLQVHFLVLQHLLRNLLTLSCYSRYCFLQLCLLFLKLRFCLVQRFFHIVRSITTTEFLLLPFTNIG* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,541.161 | ||
Theoretical pI: | 9.959 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 55.080 | ||
aromaticity | 0.114 | ||
GRAVY | 0.629 | ||
Secondary Structure Fraction | |||
Helix | 0.486 | ||
turn | 0.143 | ||
sheet | 0.324 |