Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330028.1 | 5prime_partial | 219 | 838-179(-) |
Amino Acid sequence : | |||
IVDPKTGEAKPVVIAVDDGVRPSTNMRDLAKLKPAFKKSGTTTAGNASQISDGAGAVLLMKRSIAVQKGLPILGIFRSFAAVGVEPGVMGIGPAVAIPAAVKSAGLEVSNIDLFEINEAF ASQFVYCCKKLDLDTEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDCRFGVISMCIGSGMGAAAVLERGDCVDGLTNACLAAGESNFLSKDAK* | |||
Physicochemical properties | |||
Number of amino acids: | 219 | ||
Molecular weight: | 21,326.764 | ||
Theoretical pI: | 11.604 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 63.332 | ||
aromaticity | 0.082 | ||
GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.287 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330028.1 | complete | 195 | 108-695(+) |
Amino Acid sequence : | |||
MNVTVYKVTPQFSIPYRILPWKSHHFASLDKKLLSPAARHALVRPSTQSPLSRTAAAPIPEPMHMDMTPKRQSLPRRFISFSSVATQRAPVAPKGCPRAIAPPFTFTFSVSRSNFLQQYT NWEANASFISNKSMLLTSRPADLTAAGIATAGPIPITPGSTPTAAKLLKMPRIGSPFCTAILRFMRRTAPAPSLI* | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,326.764 | ||
Theoretical pI: | 11.604 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 63.332 | ||
aromaticity | 0.082 | ||
GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.287 | ||
sheet | 0.246 |