| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330053.1 | 5prime_partial | 168 | 3-509(+) |
Amino Acid sequence : | |||
| LEEFANQLFGTKDGHGKGRQMPIHYGSNKLNFFTISSPIATQLPQAAGVAYSLKMDGKDACAVAFTGDGGTSEGDFHAAMNFAAVMEAPVMFICRNNGWAISTPTSEQFRSDGVVVKGQA YGIRSIRVDGNDALAVYSAVRAARQMVIQEQKPVLVEVKQQNKELSHF* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,174.382 | ||
| Theoretical pI: | 7.085 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 37.415 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.191 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.244 | ||
| sheet | 0.250 | ||