| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330057.1 | 5prime_partial | 226 | 1-681(+) |
Amino Acid sequence : | |||
| NWMAGLKSGWSEWEESATDSMSQVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLKQAMVGIVGSIGSAIGGAVGGGASASGGTAIQAAAAKFHFATGGFTGTGGKYEP AGIVHRGEFVFTKEATSRIGVGNLYRLMRGYATGGYVGTPGSMADSRSQASGTFEQNNHVVINNDGTNGQIGPAALKAVYDMARKGARDEIQTQMRDGGLFSGGGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 19,955.693 | ||
| Theoretical pI: | 10.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 64.457 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.232 | ||
| turn | 0.286 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330057.1 | 5prime_partial | 185 | 831-274(-) |
Amino Acid sequence : | |||
| GGQKASRCTFSGWHSARQALAENSHHQSAPFLQKGPKPHPYRVSLSSGRSSSSTSGEQATITHLCLNFITGTLAGHVIHRLQSSRTYLPVRAVVVNHHMVILLKRPGRLRPAVCHAARCT DITAGGIAAHQPVKIPHANPAGCLLREDKLTTVNNPRWLIFAAGSRKSSGCKMEFRRSGLNGCTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 19,955.693 | ||
| Theoretical pI: | 10.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 64.457 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.232 | ||
| turn | 0.286 | ||
| sheet | 0.222 | ||