Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330057.1 | 5prime_partial | 226 | 1-681(+) |
Amino Acid sequence : | |||
NWMAGLKSGWSEWEESATDSMSQVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLKQAMVGIVGSIGSAIGGAVGGGASASGGTAIQAAAAKFHFATGGFTGTGGKYEP AGIVHRGEFVFTKEATSRIGVGNLYRLMRGYATGGYVGTPGSMADSRSQASGTFEQNNHVVINNDGTNGQIGPAALKAVYDMARKGARDEIQTQMRDGGLFSGGGR* | |||
Physicochemical properties | |||
Number of amino acids: | 226 | ||
Molecular weight: | 19,955.693 | ||
Theoretical pI: | 10.906 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 64.457 | ||
aromaticity | 0.049 | ||
GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.232 | ||
turn | 0.286 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330057.1 | 5prime_partial | 185 | 831-274(-) |
Amino Acid sequence : | |||
GGQKASRCTFSGWHSARQALAENSHHQSAPFLQKGPKPHPYRVSLSSGRSSSSTSGEQATITHLCLNFITGTLAGHVIHRLQSSRTYLPVRAVVVNHHMVILLKRPGRLRPAVCHAARCT DITAGGIAAHQPVKIPHANPAGCLLREDKLTTVNNPRWLIFAAGSRKSSGCKMEFRRSGLNGCTA* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 19,955.693 | ||
Theoretical pI: | 10.906 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 64.457 | ||
aromaticity | 0.049 | ||
GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.232 | ||
turn | 0.286 | ||
sheet | 0.222 |