| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330061.1 | internal | 248 | 1-744(+) |
Amino Acid sequence : | |||
| RKSMDSFASFVDSQFSSRNRQRWSYDSLKNFRQISPVVQTHLKQVYLSLCCALLASAVGVYLHILWNVGGLLTTLGSVGCMIWLLATPSHEVQKRVSILMGAAVLEGASIGPLVQLAIDF DPSIVVSAFVGCALAFGCFSGAAMVGRRREYLYLCGLLSSGISILLWLQFASSIFGGSMALFKFELYFGLLLFVGYIVVDTQDIIEKAHLGDLDYVKHALTLFTDFVAVFVRILIIMLKN ASEKEERK | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 27,397.911 | ||
| Theoretical pI: | 8.527 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34295 | ||
| Instability index: | 38.618 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.603 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.210 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330061.1 | internal | 248 | 1-744(+) |
Amino Acid sequence : | |||
| RKSMDSFASFVDSQFSSRNRQRWSYDSLKNFRQISPVVQTHLKQVYLSLCCALLASAVGVYLHILWNVGGLLTTLGSVGCMIWLLATPSHEVQKRVSILMGAAVLEGASIGPLVQLAIDF DPSIVVSAFVGCALAFGCFSGAAMVGRRREYLYLCGLLSSGISILLWLQFASSIFGGSMALFKFELYFGLLLFVGYIVVDTQDIIEKAHLGDLDYVKHALTLFTDFVAVFVRILIIMLKN ASEKEERK | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 27,397.911 | ||
| Theoretical pI: | 8.527 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34295 | ||
| Instability index: | 38.618 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.603 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.210 | ||
| sheet | 0.282 | ||