| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330063.1 | 5prime_partial | 128 | 3-389(+) |
Amino Acid sequence : | |||
| VAPPHPRRRHGVVAKVEPTDKSIEVMRKFSEQYARKSGTYFCVDKGFTSVVIKGLAEHRDTLGAPLCPCRHYDDKAAEAQQGFWNCPCVPMRERKECHCMLFLTPDNDFAGQEQVITLDE IRETTANM* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,555.498 | ||
| Theoretical pI: | 7.079 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 44.263 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.557 | ||
Secondary Structure Fraction | |||
| Helix | 0.234 | ||
| turn | 0.180 | ||
| sheet | 0.234 | ||