Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330063.1 | 5prime_partial | 128 | 3-389(+) |
Amino Acid sequence : | |||
VAPPHPRRRHGVVAKVEPTDKSIEVMRKFSEQYARKSGTYFCVDKGFTSVVIKGLAEHRDTLGAPLCPCRHYDDKAAEAQQGFWNCPCVPMRERKECHCMLFLTPDNDFAGQEQVITLDE IRETTANM* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,555.498 | ||
Theoretical pI: | 7.079 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
Instability index: | 44.263 | ||
aromaticity | 0.078 | ||
GRAVY | -0.557 | ||
Secondary Structure Fraction | |||
Helix | 0.234 | ||
turn | 0.180 | ||
sheet | 0.234 |