Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330069.1 | internal | 249 | 1-747(+) |
Amino Acid sequence : | |||
TPQEERNRIPPISPPTMALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSA AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLF PAINVNDSV | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 16,948.264 | ||
Theoretical pI: | 9.290 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 59.797 | ||
aromaticity | 0.019 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.258 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330069.1 | 5prime_partial | 225 | 3-680(+) |
Amino Acid sequence : | |||
SPRRKKQNPPNFPSYNGAPCRENQLRPRIQGERHVSGGLRPPRNRPRRGRDARPHVVPHRIRPLPAIQGRQDHRQPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRSRQRR RLRLEGGDSPGILVVHRARARLGPRRRTGSDRRRRRRCNAVDSRGGEGGGGVREEREAAGSELHRQRRISDRVDDYQRWIEGESNEVYEDEGEIGGRFGGDDDWR* | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 16,948.264 | ||
Theoretical pI: | 9.290 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 59.797 | ||
aromaticity | 0.019 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.258 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330069.1 | 5prime_partial | 159 | 747-268(-) |
Amino Acid sequence : | |||
DRVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILRWILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRCIAAVVDDQIRSAAGAPIERALGAPPVFLE SLPLPGEDGGAVASDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 16,948.264 | ||
Theoretical pI: | 9.290 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 59.797 | ||
aromaticity | 0.019 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.258 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330069.1 | internal | 249 | 1-747(+) |
Amino Acid sequence : | |||
TPQEERNRIPPISPPTMALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSA AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLF PAINVNDSV | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 16,948.264 | ||
Theoretical pI: | 9.290 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 59.797 | ||
aromaticity | 0.019 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.258 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330069.1 | 5prime_partial | 225 | 3-680(+) |
Amino Acid sequence : | |||
SPRRKKQNPPNFPSYNGAPCRENQLRPRIQGERHVSGGLRPPRNRPRRGRDARPHVVPHRIRPLPAIQGRQDHRQPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRSRQRR RLRLEGGDSPGILVVHRARARLGPRRRTGSDRRRRRRCNAVDSRGGEGGGGVREEREAAGSELHRQRRISDRVDDYQRWIEGESNEVYEDEGEIGGRFGGDDDWR* | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 16,948.264 | ||
Theoretical pI: | 9.290 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 59.797 | ||
aromaticity | 0.019 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.258 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330069.1 | 5prime_partial | 159 | 747-268(-) |
Amino Acid sequence : | |||
DRVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILRWILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRCIAAVVDDQIRSAAGAPIERALGAPPVFLE SLPLPGEDGGAVASDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 16,948.264 | ||
Theoretical pI: | 9.290 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 59.797 | ||
aromaticity | 0.019 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.258 | ||
sheet | 0.308 |