| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330074.1 | 5prime_partial | 125 | 623-246(-) |
Amino Acid sequence : | |||
| ALACIHLPSSSISLGMAAHNPVSRSKTSAQLIDFDQLSILHPPITYIFLFNSPAAENSRATLILGPISHWFNLQSNIQTLLEGISLIEPPNTYILGPRAKIDDPTGCWGIEGRGVKVRLG FWGFC* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 11,324.369 | ||
| Theoretical pI: | 8.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 105.073 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.157 | ||
| turn | 0.463 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330074.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| PPTSAQEPQLRRHSSETFPTTYHSKLLPEFPASATPFCLSSQSHGTPPSIRPSFSAPAPSSAHPNPLYTSISESTLPSAGTPSKTPKILIAPSPPSPQSPSTPSDHQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,324.369 | ||
| Theoretical pI: | 8.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 105.073 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.157 | ||
| turn | 0.463 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330074.1 | 5prime_partial | 125 | 623-246(-) |
Amino Acid sequence : | |||
| ALACIHLPSSSISLGMAAHNPVSRSKTSAQLIDFDQLSILHPPITYIFLFNSPAAENSRATLILGPISHWFNLQSNIQTLLEGISLIEPPNTYILGPRAKIDDPTGCWGIEGRGVKVRLG FWGFC* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 11,324.369 | ||
| Theoretical pI: | 8.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 105.073 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.157 | ||
| turn | 0.463 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330074.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| PPTSAQEPQLRRHSSETFPTTYHSKLLPEFPASATPFCLSSQSHGTPPSIRPSFSAPAPSSAHPNPLYTSISESTLPSAGTPSKTPKILIAPSPPSPQSPSTPSDHQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,324.369 | ||
| Theoretical pI: | 8.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 105.073 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.157 | ||
| turn | 0.463 | ||
| sheet | 0.176 | ||