| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330077.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| ENLMDPSHVPYAHYGILELEKVKESSKRDREGGHEMEISVGTIDVNGFSAKHVSADYYFVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQID RFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQAMSLVFVA MAAAVSAPATRYSNG | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 11,831.497 | ||
| Theoretical pI: | 5.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 45.285 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330077.1 | complete | 102 | 469-161(-) |
Amino Acid sequence : | |||
| MPVQILELLLLDMKKKEIRIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTAVVYVRWNEVVIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,831.497 | ||
| Theoretical pI: | 5.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 45.285 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330077.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| ENLMDPSHVPYAHYGILELEKVKESSKRDREGGHEMEISVGTIDVNGFSAKHVSADYYFVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQID RFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQAMSLVFVA MAAAVSAPATRYSNG | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 11,831.497 | ||
| Theoretical pI: | 5.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 45.285 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330077.1 | complete | 102 | 469-161(-) |
Amino Acid sequence : | |||
| MPVQILELLLLDMKKKEIRIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTAVVYVRWNEVVIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,831.497 | ||
| Theoretical pI: | 5.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 45.285 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||