| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330080.1 | 5prime_partial | 258 | 2-778(+) |
Amino Acid sequence : | |||
| WIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILA DGIQDDSGNVTRFVMLAREPIIPRIDRPFKTSIVFAHEKGTSVLFKVLSAFAFRNISLTKIESRPHRHRPIRLVDDANVGTAKHFEYMFYVDFEASMADVRAQNALAEVQEFTSFLRVLG SYPMDMTPWTPSSSAAGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 15,551.095 | ||
| Theoretical pI: | 11.714 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 63.955 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.270 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330080.1 | 5prime_partial | 158 | 832-356(-) |
Amino Acid sequence : | |||
| QFTATKKIEINPRGKFGSLISGGGGRRRPRRHIHRIASEHSQEGGELLHLSQRVLCPNVGHGCFEIDVEHVLEMLRRADVGVVDEADWAVAVRPRLDLREADVAECEGGENLEQHASPLL VRENDARFERPIYPWNDWLTCEHHETRDVAGVVLDPVG* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 15,551.095 | ||
| Theoretical pI: | 11.714 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 63.955 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.270 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330080.1 | complete | 141 | 624-199(-) |
Amino Acid sequence : | |||
| MYSKCFAVPTLASSTRRIGRWRCGRDSIFVRLMLRNAKAERTLNSTLVPFSCAKTMLVLNGRSIRGMIGSRASITKRVTLPESSWIPSARIWRPYSSAARAEAIAAVSRRPFIAMYSAAP AVSSTASRMTFSPIFVSVCSH* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,551.095 | ||
| Theoretical pI: | 11.714 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 63.955 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.270 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330080.1 | 5prime_partial | 258 | 2-778(+) |
Amino Acid sequence : | |||
| WIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILA DGIQDDSGNVTRFVMLAREPIIPRIDRPFKTSIVFAHEKGTSVLFKVLSAFAFRNISLTKIESRPHRHRPIRLVDDANVGTAKHFEYMFYVDFEASMADVRAQNALAEVQEFTSFLRVLG SYPMDMTPWTPSSSAAGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 15,551.095 | ||
| Theoretical pI: | 11.714 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 63.955 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.270 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330080.1 | 5prime_partial | 158 | 832-356(-) |
Amino Acid sequence : | |||
| QFTATKKIEINPRGKFGSLISGGGGRRRPRRHIHRIASEHSQEGGELLHLSQRVLCPNVGHGCFEIDVEHVLEMLRRADVGVVDEADWAVAVRPRLDLREADVAECEGGENLEQHASPLL VRENDARFERPIYPWNDWLTCEHHETRDVAGVVLDPVG* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 15,551.095 | ||
| Theoretical pI: | 11.714 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 63.955 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.270 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330080.1 | complete | 141 | 624-199(-) |
Amino Acid sequence : | |||
| MYSKCFAVPTLASSTRRIGRWRCGRDSIFVRLMLRNAKAERTLNSTLVPFSCAKTMLVLNGRSIRGMIGSRASITKRVTLPESSWIPSARIWRPYSSAARAEAIAAVSRRPFIAMYSAAP AVSSTASRMTFSPIFVSVCSH* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,551.095 | ||
| Theoretical pI: | 11.714 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 63.955 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.270 | ||
| sheet | 0.248 | ||