Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330080.1 | 5prime_partial | 258 | 2-778(+) |
Amino Acid sequence : | |||
WIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILA DGIQDDSGNVTRFVMLAREPIIPRIDRPFKTSIVFAHEKGTSVLFKVLSAFAFRNISLTKIESRPHRHRPIRLVDDANVGTAKHFEYMFYVDFEASMADVRAQNALAEVQEFTSFLRVLG SYPMDMTPWTPSSSAAGD* | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 15,551.095 | ||
Theoretical pI: | 11.714 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 63.955 | ||
aromaticity | 0.085 | ||
GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.270 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330080.1 | 5prime_partial | 158 | 832-356(-) |
Amino Acid sequence : | |||
QFTATKKIEINPRGKFGSLISGGGGRRRPRRHIHRIASEHSQEGGELLHLSQRVLCPNVGHGCFEIDVEHVLEMLRRADVGVVDEADWAVAVRPRLDLREADVAECEGGENLEQHASPLL VRENDARFERPIYPWNDWLTCEHHETRDVAGVVLDPVG* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 15,551.095 | ||
Theoretical pI: | 11.714 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 63.955 | ||
aromaticity | 0.085 | ||
GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.270 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330080.1 | complete | 141 | 624-199(-) |
Amino Acid sequence : | |||
MYSKCFAVPTLASSTRRIGRWRCGRDSIFVRLMLRNAKAERTLNSTLVPFSCAKTMLVLNGRSIRGMIGSRASITKRVTLPESSWIPSARIWRPYSSAARAEAIAAVSRRPFIAMYSAAP AVSSTASRMTFSPIFVSVCSH* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,551.095 | ||
Theoretical pI: | 11.714 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 63.955 | ||
aromaticity | 0.085 | ||
GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.270 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330080.1 | 5prime_partial | 258 | 2-778(+) |
Amino Acid sequence : | |||
WIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILA DGIQDDSGNVTRFVMLAREPIIPRIDRPFKTSIVFAHEKGTSVLFKVLSAFAFRNISLTKIESRPHRHRPIRLVDDANVGTAKHFEYMFYVDFEASMADVRAQNALAEVQEFTSFLRVLG SYPMDMTPWTPSSSAAGD* | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 15,551.095 | ||
Theoretical pI: | 11.714 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 63.955 | ||
aromaticity | 0.085 | ||
GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.270 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330080.1 | 5prime_partial | 158 | 832-356(-) |
Amino Acid sequence : | |||
QFTATKKIEINPRGKFGSLISGGGGRRRPRRHIHRIASEHSQEGGELLHLSQRVLCPNVGHGCFEIDVEHVLEMLRRADVGVVDEADWAVAVRPRLDLREADVAECEGGENLEQHASPLL VRENDARFERPIYPWNDWLTCEHHETRDVAGVVLDPVG* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 15,551.095 | ||
Theoretical pI: | 11.714 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 63.955 | ||
aromaticity | 0.085 | ||
GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.270 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330080.1 | complete | 141 | 624-199(-) |
Amino Acid sequence : | |||
MYSKCFAVPTLASSTRRIGRWRCGRDSIFVRLMLRNAKAERTLNSTLVPFSCAKTMLVLNGRSIRGMIGSRASITKRVTLPESSWIPSARIWRPYSSAARAEAIAAVSRRPFIAMYSAAP AVSSTASRMTFSPIFVSVCSH* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,551.095 | ||
Theoretical pI: | 11.714 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 63.955 | ||
aromaticity | 0.085 | ||
GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.270 | ||
sheet | 0.248 |