| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330082.1 | 5prime_partial | 230 | 1-693(+) |
Amino Acid sequence : | |||
| CPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDR SGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGNFRYQKTAAYGHFGRDDPDFTWETVKILKPKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 25,165.461 | ||
| Theoretical pI: | 8.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
| Instability index: | 9.809 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.250 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.230 | ||
| sheet | 0.174 | ||