Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330082.1 | 5prime_partial | 230 | 1-693(+) |
Amino Acid sequence : | |||
CPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDR SGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGNFRYQKTAAYGHFGRDDPDFTWETVKILKPKA* | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 25,165.461 | ||
Theoretical pI: | 8.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
Instability index: | 9.809 | ||
aromaticity | 0.087 | ||
GRAVY | -0.250 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.230 | ||
sheet | 0.174 |