Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330095.1 | 3prime_partial | 263 | 36-824(+) |
Amino Acid sequence : | |||
MEFKNLSILAFLSVAIVVSHAALPSEEYWSSALPNTVMPKSVKDLLTDDKSGVNVGVNVGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLY AGNKMTLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPV VVCHQQEYEYAVFYCHKTETTVA | |||
Physicochemical properties | |||
Number of amino acids: | 263 | ||
Molecular weight: | 11,726.681 | ||
Theoretical pI: | 10.241 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 48.425 | ||
aromaticity | 0.109 | ||
GRAVY | 0.298 | ||
Secondary Structure Fraction | |||
Helix | 0.426 | ||
turn | 0.158 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330095.1 | 5prime_partial | 101 | 824-519(-) |
Amino Acid sequence : | |||
GHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFFDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,726.681 | ||
Theoretical pI: | 10.241 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 48.425 | ||
aromaticity | 0.109 | ||
GRAVY | 0.298 | ||
Secondary Structure Fraction | |||
Helix | 0.426 | ||
turn | 0.158 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330095.1 | 3prime_partial | 263 | 36-824(+) |
Amino Acid sequence : | |||
MEFKNLSILAFLSVAIVVSHAALPSEEYWSSALPNTVMPKSVKDLLTDDKSGVNVGVNVGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLY AGNKMTLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPV VVCHQQEYEYAVFYCHKTETTVA | |||
Physicochemical properties | |||
Number of amino acids: | 263 | ||
Molecular weight: | 11,726.681 | ||
Theoretical pI: | 10.241 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 48.425 | ||
aromaticity | 0.109 | ||
GRAVY | 0.298 | ||
Secondary Structure Fraction | |||
Helix | 0.426 | ||
turn | 0.158 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330095.1 | 5prime_partial | 101 | 824-519(-) |
Amino Acid sequence : | |||
GHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFFDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,726.681 | ||
Theoretical pI: | 10.241 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 48.425 | ||
aromaticity | 0.109 | ||
GRAVY | 0.298 | ||
Secondary Structure Fraction | |||
Helix | 0.426 | ||
turn | 0.158 | ||
sheet | 0.257 |