Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330098.1 | internal | 117 | 3-353(+) |
Amino Acid sequence : | |||
VFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSH | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,915.708 | ||
Theoretical pI: | 9.007 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
Instability index: | 55.723 | ||
aromaticity | 0.162 | ||
GRAVY | -0.401 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.205 | ||
sheet | 0.171 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330098.1 | internal | 117 | 3-353(+) |
Amino Acid sequence : | |||
VFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSH | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,915.708 | ||
Theoretical pI: | 9.007 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
Instability index: | 55.723 | ||
aromaticity | 0.162 | ||
GRAVY | -0.401 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.205 | ||
sheet | 0.171 |