| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330098.1 | internal | 117 | 3-353(+) |
Amino Acid sequence : | |||
| VFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSH | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,915.708 | ||
| Theoretical pI: | 9.007 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
| Instability index: | 55.723 | ||
| aromaticity | 0.162 | ||
| GRAVY | -0.401 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.205 | ||
| sheet | 0.171 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330098.1 | internal | 117 | 3-353(+) |
Amino Acid sequence : | |||
| VFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSH | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,915.708 | ||
| Theoretical pI: | 9.007 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
| Instability index: | 55.723 | ||
| aromaticity | 0.162 | ||
| GRAVY | -0.401 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.205 | ||
| sheet | 0.171 | ||