| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330106.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| QVLHLHAMEVLQASSLSFQLLRRHSRNNLINKFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWK VFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILA ENLMDPSHVSYAHYGILELEK | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 30,248.377 | ||
| Theoretical pI: | 8.082 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 64400 64900 | ||
| Instability index: | 50.933 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.230 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330106.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| QVLHLHAMEVLQASSLSFQLLRRHSRNNLINKFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWK VFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILA ENLMDPSHVSYAHYGILELEK | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 30,248.377 | ||
| Theoretical pI: | 8.082 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 64400 64900 | ||
| Instability index: | 50.933 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.230 | ||
| sheet | 0.203 | ||