| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330114.1 | internal | 209 | 1-627(+) |
Amino Acid sequence : | |||
| GFHPDAGASYYLSRLPGYLGEFLALTGEKLSGAEMMACGLATHYSLKEKLPWVEERLGSLKTDEPSVIDTALAQYGTLVHPDERSVLYKIETIDSLFCHDTVEEIVEALENKVAESGDKW YANVLKKIKESPPLSLKVALQSIREGRFQTLDQCLAREYRASLKFISKEFSNDFSEGVRARLIDKDFAPKWSPAKLEEVSDSMVASFFS | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 23,408.320 | ||
| Theoretical pI: | 5.138 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
| Instability index: | 34.710 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.215 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330114.1 | internal | 209 | 1-627(+) |
Amino Acid sequence : | |||
| GFHPDAGASYYLSRLPGYLGEFLALTGEKLSGAEMMACGLATHYSLKEKLPWVEERLGSLKTDEPSVIDTALAQYGTLVHPDERSVLYKIETIDSLFCHDTVEEIVEALENKVAESGDKW YANVLKKIKESPPLSLKVALQSIREGRFQTLDQCLAREYRASLKFISKEFSNDFSEGVRARLIDKDFAPKWSPAKLEEVSDSMVASFFS | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 23,408.320 | ||
| Theoretical pI: | 5.138 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
| Instability index: | 34.710 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.215 | ||
| sheet | 0.321 | ||