| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330120.1 | 5prime_partial | 133 | 3-404(+) |
Amino Acid sequence : | |||
| YLIADGGNVDVVSVENGIVSLQLQGACGSCPSSTTTMKMGIERVLKEKFGDAIKDICQVNDEQQITETTVEAVNRHLDVLRPAIKNYGGSVEVLSVEGGDCTVRYVGPDSIGSGIKAAIK ERFPDIVNVEFTN* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,204.900 | ||
| Theoretical pI: | 4.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 33.149 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.256 | ||
| sheet | 0.195 | ||