| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330123.1 | internal | 271 | 2-814(+) |
Amino Acid sequence : | |||
| FVWVGQSVDSKEKQTAFDIGQKYIELAASLEGLPPNVPLYKVAEGNEPCFFTTYFSWDPAKATAHGNSFQKKVMLLFGAGHSAEERSNSSNNGGPTQRASALAALNSAFSSTPSPKASPA SRSGGKGQGSQRAAAVAALSSVLTAEKKGSNEVSPARPSGSPPAEASHSAPVKGENANEIEDSKEGSKVKENATTESIPETNGEDSGSKPEVDQDENDCESGLSTFSYDQLKAKSENPVT GIDFKRREAYLSDEEFQSVLGMNQDAFLQLP | |||
Physicochemical properties | |||
| Number of amino acids: | 271 | ||
| Molecular weight: | 28,644.912 | ||
| Theoretical pI: | 4.889 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 49.997 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.675 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.339 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330123.1 | internal | 271 | 2-814(+) |
Amino Acid sequence : | |||
| FVWVGQSVDSKEKQTAFDIGQKYIELAASLEGLPPNVPLYKVAEGNEPCFFTTYFSWDPAKATAHGNSFQKKVMLLFGAGHSAEERSNSSNNGGPTQRASALAALNSAFSSTPSPKASPA SRSGGKGQGSQRAAAVAALSSVLTAEKKGSNEVSPARPSGSPPAEASHSAPVKGENANEIEDSKEGSKVKENATTESIPETNGEDSGSKPEVDQDENDCESGLSTFSYDQLKAKSENPVT GIDFKRREAYLSDEEFQSVLGMNQDAFLQLP | |||
Physicochemical properties | |||
| Number of amino acids: | 271 | ||
| Molecular weight: | 28,644.912 | ||
| Theoretical pI: | 4.889 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 49.997 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.675 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.339 | ||
| sheet | 0.273 | ||