Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330127.1	5prime_partial	238	1-717(+)
Amino Acid sequence :
HVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLKHAVKNTVSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLV DHALDNGDNEKNVSTSIFHKIEAFEEELKALLPKEVESARIAVESGNPAIANRIVECRSYPLYRFIREELGASFLTGEKAISPGEECDRVFTALSKGLIVDPLLECLHGWNGAPLPIC*
Physicochemical properties
Number of amino acids:		238
Molecular weight:		26,571.112
Theoretical pI:		5.527
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14815
Instability index:		39.870
aromaticity		0.059
GRAVY		-0.159
Secondary Structure Fraction
Helix		0.315
turn		0.206
sheet		0.311