Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330130.1	5prime_partial	216	1-651(+)
Amino Acid sequence :
PTREYYHRHTRCLYWEGKLILPFADQWWFRYTLGWLMPPKVSLLKATQGEAIRNYYHEMHVIQDMLVPLYKVGDALEWVHREMEVYPIWLCPHRLYKLPMKTMVYPEPGFELQRRQGDTH YAQMYTDVGVYYAPGPVLRGEEFDGAEAVRRMEDWLIENHGFQPQYAVSELNEKNFWRMFDAGLYEHCRRKYGAIGTFMSVYYKSKKGRKTEKEVQ*
Physicochemical properties
Number of amino acids:		216
Molecular weight:		26,051.652
Theoretical pI:		8.434
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		72310 72435
Instability index:		49.220
aromaticity		0.162
GRAVY		-0.633
Secondary Structure Fraction
Helix		0.338
turn		0.167
sheet		0.269