Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330134.1 | internal | 239 | 718-2(-) |
Amino Acid sequence : | |||
NVMSEQKKTWAAEDQLRGNWMAGLKSGWSEWKESATDSMSQVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLKQAMVGIVGSIGSAIGGAVGGGASASGGTAIQAAAA KFHFATGGFTGTGGKYEPAGIVHRGEFVFTKEATSRIGVGNLYRLMRGYATGGYVGTLGSMADSRSQASGTFEQNNHVVINNDGTNGQIGPAALKAVYDMARKGARDEIQTQMRDGGLF | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 12,321.536 | ||
Theoretical pI: | 6.503 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
Instability index: | 53.325 | ||
aromaticity | 0.078 | ||
GRAVY | 0.676 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.243 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330134.1 | 5prime_partial | 129 | 2-391(+) |
Amino Acid sequence : | |||
EQATITHLCLNFITGTLAGHVIHRLQSSRTYLPVRAVVVNHHMVILLKRPGRLRPAVCHAAQCTDITAGGIAAHQPVKIPHANPAGCLLREDKLTTVNNPRWLIFAAGSRKSSGCKMEFR RSGLNGCTA* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 12,321.536 | ||
Theoretical pI: | 6.503 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
Instability index: | 53.325 | ||
aromaticity | 0.078 | ||
GRAVY | 0.676 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.243 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330134.1 | 3prime_partial | 115 | 375-719(+) |
Amino Acid sequence : | |||
MAVPPDADAPPPTAPPMALPILPTIPTIACLSRISVIMDSTERVKLRQFCSLPVSIAAIFCAIPSKVCVAALFTCDILSVALSFHSLQPDFKPAIQFPRSWSSAAQVFFCSDMTL | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,321.536 | ||
Theoretical pI: | 6.503 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
Instability index: | 53.325 | ||
aromaticity | 0.078 | ||
GRAVY | 0.676 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.243 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330134.1 | internal | 239 | 718-2(-) |
Amino Acid sequence : | |||
NVMSEQKKTWAAEDQLRGNWMAGLKSGWSEWKESATDSMSQVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLKQAMVGIVGSIGSAIGGAVGGGASASGGTAIQAAAA KFHFATGGFTGTGGKYEPAGIVHRGEFVFTKEATSRIGVGNLYRLMRGYATGGYVGTLGSMADSRSQASGTFEQNNHVVINNDGTNGQIGPAALKAVYDMARKGARDEIQTQMRDGGLF | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 12,321.536 | ||
Theoretical pI: | 6.503 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
Instability index: | 53.325 | ||
aromaticity | 0.078 | ||
GRAVY | 0.676 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.243 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330134.1 | 5prime_partial | 129 | 2-391(+) |
Amino Acid sequence : | |||
EQATITHLCLNFITGTLAGHVIHRLQSSRTYLPVRAVVVNHHMVILLKRPGRLRPAVCHAAQCTDITAGGIAAHQPVKIPHANPAGCLLREDKLTTVNNPRWLIFAAGSRKSSGCKMEFR RSGLNGCTA* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 12,321.536 | ||
Theoretical pI: | 6.503 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
Instability index: | 53.325 | ||
aromaticity | 0.078 | ||
GRAVY | 0.676 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.243 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330134.1 | 3prime_partial | 115 | 375-719(+) |
Amino Acid sequence : | |||
MAVPPDADAPPPTAPPMALPILPTIPTIACLSRISVIMDSTERVKLRQFCSLPVSIAAIFCAIPSKVCVAALFTCDILSVALSFHSLQPDFKPAIQFPRSWSSAAQVFFCSDMTL | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,321.536 | ||
Theoretical pI: | 6.503 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
Instability index: | 53.325 | ||
aromaticity | 0.078 | ||
GRAVY | 0.676 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.243 | ||
sheet | 0.261 |