| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330147.1 | 5prime_partial | 128 | 3-389(+) |
Amino Acid sequence : | |||
| VRRREFREEAHWTWRAVDGKRRSGDERLAVLHLYGEDGVAGWEACGVRAGCGGIRRREGDREGRIWQRKDLEAGCDCRLRSTLDLSRDDLLLYRSDDDLSFNFTAVSVPSRCLFGIMRGR SSEFSLSF* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,730.341 | ||
| Theoretical pI: | 8.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 59.540 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.653 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.211 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330147.1 | 5prime_partial | 128 | 3-389(+) |
Amino Acid sequence : | |||
| VRRREFREEAHWTWRAVDGKRRSGDERLAVLHLYGEDGVAGWEACGVRAGCGGIRRREGDREGRIWQRKDLEAGCDCRLRSTLDLSRDDLLLYRSDDDLSFNFTAVSVPSRCLFGIMRGR SSEFSLSF* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,730.341 | ||
| Theoretical pI: | 8.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 59.540 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.653 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.211 | ||
| sheet | 0.250 | ||