Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330152.1 | 3prime_partial | 274 | 55-876(+) |
Amino Acid sequence : | |||
MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVI GGPHGDAGLTGRKIIIDTYGGWGAHGGSAFSGRI | |||
Physicochemical properties | |||
Number of amino acids: | 274 | ||
Molecular weight: | 13,665.285 | ||
Theoretical pI: | 4.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 43.824 | ||
aromaticity | 0.049 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.238 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330152.1 | 5prime_partial | 122 | 876-508(-) |
Amino Acid sequence : | |||
DPTRESTSTMSTPATICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPH FS* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,665.285 | ||
Theoretical pI: | 4.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 43.824 | ||
aromaticity | 0.049 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.238 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330152.1 | 3prime_partial | 274 | 55-876(+) |
Amino Acid sequence : | |||
MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVI GGPHGDAGLTGRKIIIDTYGGWGAHGGSAFSGRI | |||
Physicochemical properties | |||
Number of amino acids: | 274 | ||
Molecular weight: | 13,665.285 | ||
Theoretical pI: | 4.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 43.824 | ||
aromaticity | 0.049 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.238 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330152.1 | 5prime_partial | 122 | 876-508(-) |
Amino Acid sequence : | |||
DPTRESTSTMSTPATICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPH FS* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,665.285 | ||
Theoretical pI: | 4.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 43.824 | ||
aromaticity | 0.049 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.238 | ||
sheet | 0.221 |