| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330162.1 | internal | 264 | 3-794(+) |
Amino Acid sequence : | |||
| TKFKMEIHREEIIFRSKLPDIYIPKHLPLHSYCFENLHNFSQRPCLIDGATGHVHTYEEVELTARKVATGLSKLGIQQGQTIMLLLPNSPQFVFAFLGASYIGAISTMANPYFTPAEVIK QATASAAKLIITQSCYIHKVQDYASRNQIKLMCVDAPPTGCLPFSDLTDSDERDMPAVKIHPDDAVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSEDVMLCVLPLFHI YSLNSVLLCGLRVGAGILLMHKFD | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 17,931.103 | ||
| Theoretical pI: | 9.290 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 44.249 | ||
| aromaticity | 0.012 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.201 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330162.1 | 5prime_partial | 164 | 794-300(-) |
Amino Acid sequence : | |||
| VKFVHEQDARPHPQPAQQHRIQRVDVEQRQHAQHHILAMNVQIRILPVDLLRHARHQPLVRQHHALGQPRRAGGIRQRHRVVGVDLHSWHVALVGIRQIGEGKAACRRRVDAHELDLVAR GVVLHLVDVAGLSDDELGSGGGGLLDDLGGGEVGIGHGGNGADV* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,931.103 | ||
| Theoretical pI: | 9.290 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 44.249 | ||
| aromaticity | 0.012 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.201 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330162.1 | internal | 264 | 3-794(+) |
Amino Acid sequence : | |||
| TKFKMEIHREEIIFRSKLPDIYIPKHLPLHSYCFENLHNFSQRPCLIDGATGHVHTYEEVELTARKVATGLSKLGIQQGQTIMLLLPNSPQFVFAFLGASYIGAISTMANPYFTPAEVIK QATASAAKLIITQSCYIHKVQDYASRNQIKLMCVDAPPTGCLPFSDLTDSDERDMPAVKIHPDDAVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSEDVMLCVLPLFHI YSLNSVLLCGLRVGAGILLMHKFD | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 17,931.103 | ||
| Theoretical pI: | 9.290 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 44.249 | ||
| aromaticity | 0.012 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.201 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330162.1 | 5prime_partial | 164 | 794-300(-) |
Amino Acid sequence : | |||
| VKFVHEQDARPHPQPAQQHRIQRVDVEQRQHAQHHILAMNVQIRILPVDLLRHARHQPLVRQHHALGQPRRAGGIRQRHRVVGVDLHSWHVALVGIRQIGEGKAACRRRVDAHELDLVAR GVVLHLVDVAGLSDDELGSGGGGLLDDLGGGEVGIGHGGNGADV* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,931.103 | ||
| Theoretical pI: | 9.290 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 44.249 | ||
| aromaticity | 0.012 | ||
| GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.201 | ||
| sheet | 0.232 | ||