Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330178.1 | 5prime_partial | 132 | 3-401(+) |
Amino Acid sequence : | |||
PETLPDGTVNLMVWHCTIPGKSGTDWEGGYYPLTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDACEYKKR VRSQAKLYPPLV* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,835.726 | ||
Theoretical pI: | 5.738 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 61.996 | ||
aromaticity | 0.114 | ||
GRAVY | -0.442 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.280 | ||
sheet | 0.182 |