Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330195.1 | internal | 274 | 3-824(+) |
Amino Acid sequence : | |||
FVWTENEEKQRAKVKEKLDKCVKEKLLDFCAVLNIPVNKATVKKEELSTKLLEFLESPHATSDMLLADKEKGKKRKSTDTAIKSPGSSNLSGGKNTKNQKLDSESGKKRKHSSEEENDDK SEQSQSEDDQEDDDKVPRVETDDKENEFGEETGEEQGVSDTQLAETSSKKDSEKTAEKSTGKKGPAKALDAPAKSTKKSSSSVSKKSATKTESKSKQKATPTKKQKSENKSEVDTSTPAK AKAASKSSSKVLKKDQEGKSNKKAKKKPSREKMH | |||
Physicochemical properties | |||
Number of amino acids: | 274 | ||
Molecular weight: | 16,500.470 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 68.074 | ||
aromaticity | 0.044 | ||
GRAVY | -0.430 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.148 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330195.1 | complete | 135 | 352-759(+) |
Amino Acid sequence : | |||
MMIKVNNHKVKMIRKMMTKFLGWKLMIKRMSLGKRRVKSKVCPIRSWLRQVPRKILKRLLRSLLVKKVQQKLWMHLRNLLKNLPVLYPRKVLLKPSQRVNRRQRQLRNKNLKIKVRLIQV HLQRLKLQASLQAKF* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 16,500.470 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 68.074 | ||
aromaticity | 0.044 | ||
GRAVY | -0.430 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.148 | ||
sheet | 0.252 |