| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330195.1 | internal | 274 | 3-824(+) |
Amino Acid sequence : | |||
| FVWTENEEKQRAKVKEKLDKCVKEKLLDFCAVLNIPVNKATVKKEELSTKLLEFLESPHATSDMLLADKEKGKKRKSTDTAIKSPGSSNLSGGKNTKNQKLDSESGKKRKHSSEEENDDK SEQSQSEDDQEDDDKVPRVETDDKENEFGEETGEEQGVSDTQLAETSSKKDSEKTAEKSTGKKGPAKALDAPAKSTKKSSSSVSKKSATKTESKSKQKATPTKKQKSENKSEVDTSTPAK AKAASKSSSKVLKKDQEGKSNKKAKKKPSREKMH | |||
Physicochemical properties | |||
| Number of amino acids: | 274 | ||
| Molecular weight: | 16,500.470 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 68.074 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.430 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.148 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330195.1 | complete | 135 | 352-759(+) |
Amino Acid sequence : | |||
| MMIKVNNHKVKMIRKMMTKFLGWKLMIKRMSLGKRRVKSKVCPIRSWLRQVPRKILKRLLRSLLVKKVQQKLWMHLRNLLKNLPVLYPRKVLLKPSQRVNRRQRQLRNKNLKIKVRLIQV HLQRLKLQASLQAKF* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 16,500.470 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 68.074 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.430 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.148 | ||
| sheet | 0.252 | ||