| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330197.1 | 5prime_partial | 155 | 3-470(+) |
Amino Acid sequence : | |||
| NQHEIQPISSLKNPPKKTLKNLCKNDAHDLLLGQKRDHPLRFMEDRFMAELLPLSLRRLPPLRLLPVHGGPPPPIAPPPPPRQVDAALRRRNPSSNPQAARPQLGPAPIFGGDSLRSQLG DRVFSDAGRDVVQRRRFHRDRGRPRRRVLDFPRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 14,162.401 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 48.270 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.248 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330197.1 | complete | 144 | 76-510(+) |
Amino Acid sequence : | |||
| MMHMTFYWGRSVTILFDSWKTDSWPSYFLSLFAVFLLSVFYQYMEDRRLRLRLLHLPAKSTPPSAAETPLLIPKLRGRSWAPHQFLGAILFGVNSAIGYFLMLAVMSFNGGVFIAIVVGL AVGYLIFRGGDEDVVIVDNPCACA* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 14,162.401 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 48.270 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.248 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330197.1 | 5prime_partial | 125 | 663-286(-) |
Amino Acid sequence : | |||
| TPRSNFSLINKERKKKTHNSRSNLQTSSQKGQEEIEKIRLNTNYITNPIHKSRAGTRIINDHHILIAAAENQVPDGEADHDRDENAAVERHHGQHQKIPDRRVDSEENRPQKLVRGPAAA AQLGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,162.401 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 48.270 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.248 | ||
| sheet | 0.216 | ||