| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330203.1 | 5prime_partial | 188 | 2-568(+) |
Amino Acid sequence : | |||
| VTSISAYLSGRTSNNVKLDTFPEIIPCSIIHPDTRSCLAHNANAAKDTFRKTFPLYFSLTFVPFVVLRLQKFMDAPVRTCKHAVTNAVRSTSFLSAFVGIFQGAICLHRKVAVKDHKLVY WLAGGLSALSVLLEKKARRGELALYVLPRAGESLWYILVNRRLLPDIKNAEVALFCWCNGWNHVLPGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,974.372 | ||
| Theoretical pI: | 9.758 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29825 | ||
| Instability index: | 38.032 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.213 | ||
| sheet | 0.261 | ||