Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330203.1	5prime_partial	188	2-568(+)
Amino Acid sequence :
VTSISAYLSGRTSNNVKLDTFPEIIPCSIIHPDTRSCLAHNANAAKDTFRKTFPLYFSLTFVPFVVLRLQKFMDAPVRTCKHAVTNAVRSTSFLSAFVGIFQGAICLHRKVAVKDHKLVY WLAGGLSALSVLLEKKARRGELALYVLPRAGESLWYILVNRRLLPDIKNAEVALFCWCNGWNHVLPGA*
Physicochemical properties
Number of amino acids:		188
Molecular weight:		20,974.372
Theoretical pI:		9.758
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29450 29825
Instability index:		38.032
aromaticity		0.106
GRAVY		0.247
Secondary Structure Fraction
Helix		0.372
turn		0.213
sheet		0.261