| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330204.1 | internal | 253 | 2-760(+) |
Amino Acid sequence : | |||
| GRIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMIKRIKEQGLDITPRILIVTRLLPDAVGTTCGQKLEKVFGAEHSHILRVPFRTEKGIVRKWISRFEVWPYMETF AEDVAKEIAVELQGKPDLIIGNYSEGNLAASLLAHKLGVTQCTIAHALEKTKYPDSDIYLKKFDEKYHFSCQFTADLYAMNHTDFIITSTFQEIAGSKDTVGQYESHMAFTMPGLYRVVH GIDVFNPKSTSFH | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 28,585.537 | ||
| Theoretical pI: | 6.215 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 26.121 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.190 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330204.1 | internal | 253 | 2-760(+) |
Amino Acid sequence : | |||
| GRIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMIKRIKEQGLDITPRILIVTRLLPDAVGTTCGQKLEKVFGAEHSHILRVPFRTEKGIVRKWISRFEVWPYMETF AEDVAKEIAVELQGKPDLIIGNYSEGNLAASLLAHKLGVTQCTIAHALEKTKYPDSDIYLKKFDEKYHFSCQFTADLYAMNHTDFIITSTFQEIAGSKDTVGQYESHMAFTMPGLYRVVH GIDVFNPKSTSFH | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 28,585.537 | ||
| Theoretical pI: | 6.215 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 26.121 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.190 | ||
| sheet | 0.233 | ||