| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330208.1 | 5prime_partial | 234 | 3-707(+) |
Amino Acid sequence : | |||
| PPQKWGSLWCVRGMVAYEGMGPFHDNIRRRNSKKRESSKRESKPSNSAETTAAGYQFPLKQSAISAVLCSTGDTIAQLRHRWVKNKDTLSHSQDFKDTVSTLLSEHDYIRSLRMISYGFL LYGPGSYAWYQYLDRCMPHKNIQNLTTKVVLNQIVLGPAVIGVIFAWNNLWLGKLSELPNKYKNDALPTLFTGFKFWIPVSILNFGVIPLQARVAFMSTSSIFWNFYLSTTMSR* | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 10,660.337 | ||
| Theoretical pI: | 9.822 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 64.997 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.229 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.384 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330208.1 | 5prime_partial | 99 | 1-300(+) |
Amino Acid sequence : | |||
| PPPKNGGLCGACGEWWLMREWAHSTITFGGVIVRKESLVKENLSPPIQLKPPPPVTSFPSSSPPSAPFFARPETPLPSCATAGSRTKTPFPTLKILRIP* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,660.337 | ||
| Theoretical pI: | 9.822 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 64.997 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.229 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.384 | ||
| sheet | 0.202 | ||