Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330208.1 | 5prime_partial | 234 | 3-707(+) |
Amino Acid sequence : | |||
PPQKWGSLWCVRGMVAYEGMGPFHDNIRRRNSKKRESSKRESKPSNSAETTAAGYQFPLKQSAISAVLCSTGDTIAQLRHRWVKNKDTLSHSQDFKDTVSTLLSEHDYIRSLRMISYGFL LYGPGSYAWYQYLDRCMPHKNIQNLTTKVVLNQIVLGPAVIGVIFAWNNLWLGKLSELPNKYKNDALPTLFTGFKFWIPVSILNFGVIPLQARVAFMSTSSIFWNFYLSTTMSR* | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 10,660.337 | ||
Theoretical pI: | 9.822 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 64.997 | ||
aromaticity | 0.081 | ||
GRAVY | -0.229 | ||
Secondary Structure Fraction | |||
Helix | 0.253 | ||
turn | 0.384 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330208.1 | 5prime_partial | 99 | 1-300(+) |
Amino Acid sequence : | |||
PPPKNGGLCGACGEWWLMREWAHSTITFGGVIVRKESLVKENLSPPIQLKPPPPVTSFPSSSPPSAPFFARPETPLPSCATAGSRTKTPFPTLKILRIP* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,660.337 | ||
Theoretical pI: | 9.822 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 64.997 | ||
aromaticity | 0.081 | ||
GRAVY | -0.229 | ||
Secondary Structure Fraction | |||
Helix | 0.253 | ||
turn | 0.384 | ||
sheet | 0.202 |