| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330209.1 | 5prime_partial | 133 | 1-402(+) |
Amino Acid sequence : | |||
| DFPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAQRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALLSIREEIALIEKGKADINNNVLKSAPHPPSLLMADVWTKPYSQ KYAALPCSMAQDC* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,751.736 | ||
| Theoretical pI: | 4.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 46.771 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.233 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330209.1 | 5prime_partial | 133 | 1-402(+) |
Amino Acid sequence : | |||
| DFPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAQRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALLSIREEIALIEKGKADINNNVLKSAPHPPSLLMADVWTKPYSQ KYAALPCSMAQDC* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,751.736 | ||
| Theoretical pI: | 4.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 46.771 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.233 | ||
| sheet | 0.301 | ||