| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330216.1 | internal | 237 | 2-712(+) |
Amino Acid sequence : | |||
| PPPKSQHSFLLLRLRSETTRFAIRRDMETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLV NIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 21,844.890 | ||
| Theoretical pI: | 7.296 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 19.830 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330216.1 | 5prime_partial | 206 | 712-92(-) |
Amino Acid sequence : | |||
| LEIGSNFVVSDSLVVLCGDQHGVDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQLGGLVRGIAKHVTLVTSTDFFRSFGEVAVNTLSNIRALLLNIHQN LAIISIKAYIIRNKSNGTASVTDNLLVVDISLGCNLSEHHDHVSLGACLTGNLAVRVLSETGIKHRIGDLIAQLVGVALIHRLRCK* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 21,844.890 | ||
| Theoretical pI: | 7.296 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 19.830 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330216.1 | internal | 237 | 2-712(+) |
Amino Acid sequence : | |||
| PPPKSQHSFLLLRLRSETTRFAIRRDMETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLV NIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 21,844.890 | ||
| Theoretical pI: | 7.296 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 19.830 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330216.1 | 5prime_partial | 206 | 712-92(-) |
Amino Acid sequence : | |||
| LEIGSNFVVSDSLVVLCGDQHGVDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQLGGLVRGIAKHVTLVTSTDFFRSFGEVAVNTLSNIRALLLNIHQN LAIISIKAYIIRNKSNGTASVTDNLLVVDISLGCNLSEHHDHVSLGACLTGNLAVRVLSETGIKHRIGDLIAQLVGVALIHRLRCK* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 21,844.890 | ||
| Theoretical pI: | 7.296 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 19.830 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||