Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330223.1 | internal | 221 | 3-665(+) |
Amino Acid sequence : | |||
ESREQGLDITPRILIVTRLLPDAVGTTCGQKLEKVFGAEHSHILRVPFRTEKGIVRKWISRFEVWPYMETFAEDVAKEIAVELQGKPDLIIGNYSEGNLAASLLAHKLGVTQCTIAHALE KTKYPDSDIYLKKFDEKYHFSCQFTADLYAMNHTDFIITSTFQEIAGSKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMNLYFPYTEKEKR | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 25,146.456 | ||
Theoretical pI: | 5.918 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 32.514 | ||
aromaticity | 0.113 | ||
GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.181 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330223.1 | internal | 221 | 3-665(+) |
Amino Acid sequence : | |||
ESREQGLDITPRILIVTRLLPDAVGTTCGQKLEKVFGAEHSHILRVPFRTEKGIVRKWISRFEVWPYMETFAEDVAKEIAVELQGKPDLIIGNYSEGNLAASLLAHKLGVTQCTIAHALE KTKYPDSDIYLKKFDEKYHFSCQFTADLYAMNHTDFIITSTFQEIAGSKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMNLYFPYTEKEKR | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 25,146.456 | ||
Theoretical pI: | 5.918 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 32.514 | ||
aromaticity | 0.113 | ||
GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.181 | ||
sheet | 0.244 |