| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330227.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| VWEDLNVNLKKIGSRLLVLKGEPSEVLRRCLKEWSIKKLCFDFDTEPYYQDLDCKIRKYATDAGIEVFSPVSHTLFNPADIIEKNGGKPPLSYQSFVKLAGEPSWASSPLLTNLNWLPPV GNVGKCLISEVPSIEEIGYKDTPEDEKTIFKGGESEGLRRLRDSMANKDWVANFEKPKGDPSSLLKPATIVLSPYLKFGCVSSRYFYQCIQEVLRNCKKHTSPSVSLIGQLLW | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 26,288.972 | ||
| Theoretical pI: | 8.115 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45295 | ||
| Instability index: | 53.961 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.275 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330227.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| VWEDLNVNLKKIGSRLLVLKGEPSEVLRRCLKEWSIKKLCFDFDTEPYYQDLDCKIRKYATDAGIEVFSPVSHTLFNPADIIEKNGGKPPLSYQSFVKLAGEPSWASSPLLTNLNWLPPV GNVGKCLISEVPSIEEIGYKDTPEDEKTIFKGGESEGLRRLRDSMANKDWVANFEKPKGDPSSLLKPATIVLSPYLKFGCVSSRYFYQCIQEVLRNCKKHTSPSVSLIGQLLW | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 26,288.972 | ||
| Theoretical pI: | 8.115 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45295 | ||
| Instability index: | 53.961 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.275 | ||
| sheet | 0.227 | ||