| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330245.1 | internal | 250 | 2-751(+) |
Amino Acid sequence : | |||
| LRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTLELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVK PPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGSSDTTQI HTHMCYSNFN | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 12,387.289 | ||
| Theoretical pI: | 10.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 110.346 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.278 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330245.1 | complete | 108 | 33-359(+) |
Amino Acid sequence : | |||
| MSVPDLMLSRRSLTFRSCLPLLLVHSHRLWSSEECAVNSRPTRSPRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTLESNCLVLPSQQMAGCNPTDLAV* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,387.289 | ||
| Theoretical pI: | 10.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 110.346 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.278 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330245.1 | internal | 250 | 2-751(+) |
Amino Acid sequence : | |||
| LRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTLELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVK PPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGSSDTTQI HTHMCYSNFN | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 12,387.289 | ||
| Theoretical pI: | 10.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 110.346 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.278 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330245.1 | complete | 108 | 33-359(+) |
Amino Acid sequence : | |||
| MSVPDLMLSRRSLTFRSCLPLLLVHSHRLWSSEECAVNSRPTRSPRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTLESNCLVLPSQQMAGCNPTDLAV* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,387.289 | ||
| Theoretical pI: | 10.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 110.346 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.278 | ||
| sheet | 0.278 | ||