| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330249.1 | 5prime_partial | 211 | 3-638(+) |
Amino Acid sequence : | |||
| ARNAARILHQTAPFNHRAAMASIHTTAPSLAAASSTPTPYSSSPPPSGSSPVGMSKAAEFVISKVDDVMNYVRRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMIV AGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLLQLQKKINRRRDFYHWWTK* | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 12,716.410 | ||
| Theoretical pI: | 9.678 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 67.584 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.487 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.296 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330249.1 | 5prime_partial | 115 | 2-349(+) |
Amino Acid sequence : | |||
| GSKCCSHPPPNGAVQPPSRHGVDPHHRPIPRRRFLHADAVLLVSSPIGLIPRRNVQGGRVCDLEGGRCHELCPSRLHLADDLRIGLLRRGDDAYRRCAVRFGSVRNYFPAESEAV* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,716.410 | ||
| Theoretical pI: | 9.678 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 67.584 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.487 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.296 | ||
| sheet | 0.200 | ||