Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330249.1 | 5prime_partial | 211 | 3-638(+) |
Amino Acid sequence : | |||
ARNAARILHQTAPFNHRAAMASIHTTAPSLAAASSTPTPYSSSPPPSGSSPVGMSKAAEFVISKVDDVMNYVRRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMIV AGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLLQLQKKINRRRDFYHWWTK* | |||
Physicochemical properties | |||
Number of amino acids: | 211 | ||
Molecular weight: | 12,716.410 | ||
Theoretical pI: | 9.678 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
Instability index: | 67.584 | ||
aromaticity | 0.043 | ||
GRAVY | -0.487 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.296 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330249.1 | 5prime_partial | 115 | 2-349(+) |
Amino Acid sequence : | |||
GSKCCSHPPPNGAVQPPSRHGVDPHHRPIPRRRFLHADAVLLVSSPIGLIPRRNVQGGRVCDLEGGRCHELCPSRLHLADDLRIGLLRRGDDAYRRCAVRFGSVRNYFPAESEAV* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,716.410 | ||
Theoretical pI: | 9.678 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
Instability index: | 67.584 | ||
aromaticity | 0.043 | ||
GRAVY | -0.487 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.296 | ||
sheet | 0.200 |