| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330253.1 | internal | 276 | 1-828(+) |
Amino Acid sequence : | |||
| RIVVEKPFGKDLASAEELSSQIGELFEEPQIYRIDHYLGKELVQNLLVLRFANRFFLPLWNRDNIANVQIVFREDFGTEGRGGYFDQYGIIRDIIQNHLLQVLCLVAMEKPVSLKPEHIR DEKVKVLQSVLPINDEEVVLGQYEGYKDDPTVPDDSNTPTFATAILHIHNERWEGVPFILKAGKALNSRKAEIRVQFKDVPGDIFKCQKQGRNEFVIRLQPSEAIYMKLTVKQPGLEMST AQSELDLSYRQRYQGGVIPEAYERLILDTIKGDQQH | |||
Physicochemical properties | |||
| Number of amino acids: | 276 | ||
| Molecular weight: | 31,753.889 | ||
| Theoretical pI: | 5.507 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 46.803 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.196 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330253.1 | internal | 276 | 1-828(+) |
Amino Acid sequence : | |||
| RIVVEKPFGKDLASAEELSSQIGELFEEPQIYRIDHYLGKELVQNLLVLRFANRFFLPLWNRDNIANVQIVFREDFGTEGRGGYFDQYGIIRDIIQNHLLQVLCLVAMEKPVSLKPEHIR DEKVKVLQSVLPINDEEVVLGQYEGYKDDPTVPDDSNTPTFATAILHIHNERWEGVPFILKAGKALNSRKAEIRVQFKDVPGDIFKCQKQGRNEFVIRLQPSEAIYMKLTVKQPGLEMST AQSELDLSYRQRYQGGVIPEAYERLILDTIKGDQQH | |||
Physicochemical properties | |||
| Number of amino acids: | 276 | ||
| Molecular weight: | 31,753.889 | ||
| Theoretical pI: | 5.507 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 46.803 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.196 | ||
| sheet | 0.246 | ||