| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330267.1 | internal | 236 | 2-709(+) |
Amino Acid sequence : | |||
| RVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAMLGFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNV VMRMVAGKRFGSGDNAEETKRCRRVMRDFFYLAGFFVPADALPYLGWLDLGGHEKRMKKAAKELDEVVGEWLAEHREREFSGEGKAQDFMDVMISVVKGADLQCEFDVDTIIKATC | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 12,928.135 | ||
| Theoretical pI: | 11.727 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 67.785 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.216 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330267.1 | complete | 111 | 520-185(-) |
Amino Acid sequence : | |||
| MPTQIQPPQIRQRVRGHKKPRQIEEIPHHPPAPLRLLRIVSAAKSLSSHHPHHHIHVQLSKPPLHIHHHSLTYFCARPITFLLLPQLIKLLNKLTSFRHAHVTLELQSPIR* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,928.135 | ||
| Theoretical pI: | 11.727 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 67.785 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.216 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330267.1 | internal | 236 | 2-709(+) |
Amino Acid sequence : | |||
| RVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAMLGFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNV VMRMVAGKRFGSGDNAEETKRCRRVMRDFFYLAGFFVPADALPYLGWLDLGGHEKRMKKAAKELDEVVGEWLAEHREREFSGEGKAQDFMDVMISVVKGADLQCEFDVDTIIKATC | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 12,928.135 | ||
| Theoretical pI: | 11.727 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 67.785 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.216 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330267.1 | complete | 111 | 520-185(-) |
Amino Acid sequence : | |||
| MPTQIQPPQIRQRVRGHKKPRQIEEIPHHPPAPLRLLRIVSAAKSLSSHHPHHHIHVQLSKPPLHIHHHSLTYFCARPITFLLLPQLIKLLNKLTSFRHAHVTLELQSPIR* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,928.135 | ||
| Theoretical pI: | 11.727 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 67.785 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.216 | ||
| sheet | 0.225 | ||