| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330269.1 | complete | 133 | 191-592(+) |
Amino Acid sequence : | |||
| MASVSVHQFAQCITCHAWSPDHSMIAFCPNNNEVHIYKMLEGKWEKIHVLQKHDQLISGIDWSRLSDQIVTVSHDRNSYVWSQEGTEWVPTLVILRLNRAALCVQWSPKENKFAVGSGAK TVCVCYYEQENNW* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,348.284 | ||
| Theoretical pI: | 6.355 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44835 | ||
| Instability index: | 35.539 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.283 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.218 | ||
| sheet | 0.203 | ||