| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330276.1 | 3prime_partial | 152 | 457-2(-) |
Amino Acid sequence : | |||
| MSKIKAIRRGLPDAPLEDITTKEIAAMLNGYIDEGKAASAKLIRSTLSDAFREAIAEGHITTNHVAATRAAKSEVRRSRLTADEYLKIYQAAESSPCWLRLAMELAVVTGQRVGDLCEMK WSDIVDGYLYVEQSKTGVKIAIPHTHCYTEGG | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,697.936 | ||
| Theoretical pI: | 6.903 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 37.607 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.216 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.171 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330276.1 | 3prime_partial | 152 | 457-2(-) |
Amino Acid sequence : | |||
| MSKIKAIRRGLPDAPLEDITTKEIAAMLNGYIDEGKAASAKLIRSTLSDAFREAIAEGHITTNHVAATRAAKSEVRRSRLTADEYLKIYQAAESSPCWLRLAMELAVVTGQRVGDLCEMK WSDIVDGYLYVEQSKTGVKIAIPHTHCYTEGG | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,697.936 | ||
| Theoretical pI: | 6.903 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 37.607 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.216 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.171 | ||
| sheet | 0.316 | ||