| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330281.1 | 5prime_partial | 153 | 3-464(+) |
Amino Acid sequence : | |||
| FLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKGDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGH ELFSRLLSRAVAQAKELMDQFQLVHIVASLTLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,904.975 | ||
| Theoretical pI: | 4.628 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 37.697 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.073 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.209 | ||
| sheet | 0.294 | ||